2. Signaling Pathways
  3. Metabolic Enzyme/Protease
  4. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Related Products

PDF 1.4 MB

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-N7450
    Icariside D2
    		Inhibitor 98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-U00041
    Pivalopril
    		Inhibitor 99.19%
    Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.
    Pivalopril
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-A0043A
    Cilazapril monohydrate
    		Inhibitor 99.88%
    Cilazapril monohydrate is an orally active prodrug of the angiotensin-converting enzyme (ACE) inhibitor Cilazaprilat (HY-A0113). Cilazapril monohydrate reduces plasma ACE activity. Cilazapril monohydrate can be used in the research of hypertension (including essential and renal hypertension) and congestive heart failure.
    Cilazapril monohydrate
  • HY-P0266A
    N-Acetyl-Ser-Asp-Lys-Pro TFA
    N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.
    N-Acetyl-Ser-Asp-Lys-Pro TFA
  • HY-N8630
    Oleacein
    		Inhibitor
    Oleacein (Compound 9) is an ACE inhibitor that can be isolated from J. grandiflorum. Oleacein is orally active and can be used in the study of metabolic and cardiovascular diseases.
    Oleacein
  • HY-B0231BS
    Enalaprilat-d5 sodium
    		Inhibitor 98.0%
    Enalaprilat-d5 (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub> sodium
  • HY-B0331AR
    Enalapril maleate (Standard)
    		Inhibitor
    Enalapril (maleate) (Standard) is the analytical standard of Enalapril (maleate). This product is intended for research and analytical applications. Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalapril maleate (Standard)
  • HY-W009732R
    Sinapinic acid (Standard)
    		Inhibitor
    Sinapinic acid (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Rhizome, acts as an inhibitor of HDAC, with an IC50 of 2.27 mM, and also inhibits ACE-I activity. Sinapinic acid posssess potent anti-tumor activity, induces apoptosis of tumor cells. Sinapinic acid shows antioxidant and antidiabetic activities. Sinapinic acid reduces total cholesterol, triglyceride, and HOMA-IR index, and also normalizes some serum parameters of antioxidative abilities and oxidative damage in ovariectomized rats.
    Sinapinic acid (Standard)
  • HY-B0592R
    Trandolapril (Standard)
    		Inhibitor
    Trandolapril (Standard) is the analytical standard of Trandolapril. This product is intended for research and analytical applications. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).
    Trandolapril (Standard)
  • HY-A0116R
    Trandolaprilate (Standard)
    		Inhibitor
    Trandolaprilate (Standard) is the analytical standard of Trandolaprilate. This product is intended for research and analytical applications. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.
    Trandolaprilate (Standard)
  • HY-B1433R
    Perindoprilat (Standard)
    		Inhibitor
    Perindoprilat (Standard) is the analytical standard of Perindoprilat. This product is intended for research and analytical applications. Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC50 value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research.
    Perindoprilat (Standard)
  • HY-U00074
    Rentiapril racemate
    		Inhibitor 98.96%
    Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an angiotensin converting enzyme (ACE) inhibitor.
    Rentiapril racemate
  • HY-A0043
    Cilazapril
    		Inhibitor
    Cilazapril is an orally active prodrug of the angiotensin-converting enzyme (ACE) inhibitor Cilazaprilat (HY-A0113). Cilazapril reduces plasma ACE activity. Cilazapril can be used in the research of hypertension (including essential and renal hypertension) and congestive heart failure.
    Cilazapril
  • HY-N9528
    Lyciumin A
    		Inhibitor 99.0%
    Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
    Lyciumin A
  • HY-18207
    Fasidotril
    		Inhibitor
    Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).
    Fasidotril
  • HY-B0690
    Fosinopril
    		Inhibitor
    Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme (ACE) inhibitor with an IC50 value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an Ki value of 1.675 μM.
    Fosinopril
  • HY-118472S
    Benazeprilat-d5
    Benazeprilat-d5 is the deuterium labeled Benazeprilat.
    Benazeprilat-d<sub>5</sub>
  • HY-A0115S
    Ramiprilat-d3 (Mixture of Diastereomers)
    Ramiprilat-d3 (Mixture of Diastereomers) is the deuterium labeled Ramiprilat (Mixture of Diastereomers).
    Ramiprilat-d3 (Mixture of Diastereomers)
  • HY-N2165R
    Vicenin 2 (Standard)
    		Inhibitor
    Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium.
    Vicenin 2 (Standard)
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity